Lineage for d1a0ql1 (1a0q L:2-108)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547739Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)
  8. 547829Domain d1a0ql1: 1a0q L:2-108 [20286]
    Other proteins in same PDB: d1a0qh1, d1a0qh2, d1a0ql2
    part of catalytic antibody 29G11 with esterase activity
    complexed with hep, zn

Details for d1a0ql1

PDB Entry: 1a0q (more details), 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

SCOP Domain Sequences for d1a0ql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
ieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgipsr
frgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikr

SCOP Domain Coordinates for d1a0ql1:

Click to download the PDB-style file with coordinates for d1a0ql1.
(The format of our PDB-style files is described here.)

Timeline for d1a0ql1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0ql2