Lineage for d1a0ql1 (1a0q L:2-108)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157874Species Fab 29G11 (mouse), kappa L chain [48859] (1 PDB entry)
  8. 157876Domain d1a0ql1: 1a0q L:2-108 [20286]
    Other proteins in same PDB: d1a0qh2, d1a0ql2

Details for d1a0ql1

PDB Entry: 1a0q (more details), 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

SCOP Domain Sequences for d1a0ql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin (variable domains of L and H chains) {Fab 29G11 (mouse), kappa L chain}
ieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgipsr
frgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikr

SCOP Domain Coordinates for d1a0ql1:

Click to download the PDB-style file with coordinates for d1a0ql1.
(The format of our PDB-style files is described here.)

Timeline for d1a0ql1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0ql2