Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab 29G11 (mouse), kappa L chain [48859] (1 PDB entry) |
Domain d1a0ql1: 1a0q L:2-108 [20286] Other proteins in same PDB: d1a0qh2, d1a0ql2 |
PDB Entry: 1a0q (more details), 2.3 Å
SCOP Domain Sequences for d1a0ql1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin (variable domains of L and H chains) {Fab 29G11 (mouse), kappa L chain} ieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkqprllihytstllpgipsr frgsgsgrdysfsisnlepediatyyclqyynlrtfgggtkleikr
Timeline for d1a0ql1: