SCOP 1.67: Domain d1bvld_: 1bvl D:

Lineage for d1bvld_ (1bvl D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (27 PDB entries)

8. Domain d1bvld_: 1bvl D: [20285]
   Other proteins in same PDB: d1bvla_, d1bvlc_
   part of humanized anti-lysozyme Fv HuLys11

Details for d1bvld_

PDB Entry: 1bvl, 2.87 Å

PDB Description: humanized anti-lysozyme fv

SCOP Domain Sequences for d1bvld_:

Sequence; same for both SEQRES and ATOM records:

>d1bvld_ b.1.1.1 (D:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps
rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr

Timeline for d1bvld_:

• d1bvld_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvld_ appears in SCOP 1.65
  
• d1bvld_ appears in SCOP 1.69
  
• d1bvld_ appears in the current release, SCOPe 2.08