SCOPe 2.08: Domain d4k4xe1: 4k4x E:1-462

Lineage for d4k4xe1 (4k4x E:1-462)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein automated matches [190260] (25 species)
   not a true protein

7. Species Human coxsackievirus B3 [TaxId:12072] [193138] (3 PDB entries)

8. Domain d4k4xe1: 4k4x E:1-462 [202827]
   Other proteins in same PDB: d4k4xa2, d4k4xe2, d4k4xi2, d4k4xm2
   automated match to d4k4xa_
   protein/RNA complex; complexed with gol, mg

Details for d4k4xe1

PDB Entry: 4k4x, 2.37 Å

PDB Description: coxsackievirus b3 polymerase elongation complex (r2_form), rna

PDB Compounds: (E:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d4k4xe1:

Sequence; same for both SEQRES and ATOM records:

>d4k4xe1 e.8.1.4 (E:1-462) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas
lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecfnevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

Timeline for d4k4xe1:

• d4k4xe1 first appeared in SCOPe 2.03, called d4k4xe_
  
• d4k4xe1 appears in SCOPe 2.07