![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Engineered (including hybrid species) [88562] (67 PDB entries) SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody |
![]() | Domain d1bvla1: 1bvl A:6-116 [20282] Other proteins in same PDB: d1bvla2, d1bvlb_, d1bvlc2, d1bvld_ part of humanized anti-lysozyme Fv HuLys11 |
PDB Entry: 1bvl (more details), 2.87 Å
SCOPe Domain Sequences for d1bvla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvla1 b.1.1.1 (A:6-116) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} esgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdynsalks rvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss
Timeline for d1bvla1:
![]() Domains from other chains: (mouse over for more information) d1bvlb_, d1bvlc1, d1bvlc2, d1bvld_ |