SCOPe 2.06: Domain d4jvub_: 4jvu B:

Lineage for d4jvub_ (4jvu B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d4jvub_: 4jvu B: [202811]
   Other proteins in same PDB: d4jvua2
   automated match to d4jvua_

Details for d4jvub_

PDB Entry: 4jvu, 1.3 Å

PDB Description: IgM C2-domain from mouse

PDB Compounds: (B:) Ig mu chain C region membrane-bound form

SCOPe Domain Sequences for d4jvub_:

Sequence, based on SEQRES records:

>d4jvub_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgfttdpvti
enkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstca

Sequence, based on observed residues (ATOM records):

>d4jvub_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emnpnvnvfvpprdgfkskliceatnftpkpitvswlkdgklvesgfttdpvtieqtykv
istltiseidwlnlnvytcrvdhrgltflknvsstca

Timeline for d4jvub_:

• d4jvub_ first appeared in SCOPe 2.03
  
• d4jvub_ appears in SCOPe 2.05
  
• d4jvub_ appears in SCOPe 2.07
  
• d4jvub_ appears in the current release, SCOPe 2.08