Lineage for d1bvke_ (1bvk E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7934Species Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain [48858] (2 PDB entries)
  8. 7938Domain d1bvke_: 1bvk E: [20281]
    Other proteins in same PDB: d1bvkc_, d1bvkf_

Details for d1bvke_

PDB Entry: 1bvk (more details), 2.7 Å

PDB Description: humanized anti-lysozyme fv complexed with lysozyme

SCOP Domain Sequences for d1bvke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvke_ b.1.1.1 (E:) Immunoglobulin (variable domains of L and H chains) {Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain}
qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss

SCOP Domain Coordinates for d1bvke_:

Click to download the PDB-style file with coordinates for d1bvke_.
(The format of our PDB-style files is described here.)

Timeline for d1bvke_: