Lineage for d1bvke_ (1bvk E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain [48858] (2 PDB entries) 
Domain d1bvke_: 1bvk E: [20281]
Other proteins in same PDB: d1bvkc_, d1bvkf_
Details for d1bvke_
PDB Entry: 1bvk (more details), 2.7 Å
PDB Description: humanized anti-lysozyme fv complexed with lysozyme
SCOP Domain Sequences for d1bvke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvke_ b.1.1.1 (E:) Immunoglobulin (variable domains of L and H chains) {Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain}
qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss
SCOP Domain Coordinates for d1bvke_:
Click to download the PDB-style file with coordinates for d1bvke_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bvke_:
- d1bvke_ appears in SCOP 1.57
- d1bvke_ appears in the current release, SCOPe 2.08, called d1bvke1
View in 3D
