Lineage for d4ju0g_ (4ju0 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775883Domain d4ju0g_: 4ju0 G: [202800]
    Other proteins in same PDB: d4ju0b_, d4ju0d_, d4ju0f_, d4ju0h_, d4ju0j_, d4ju0l_
    automated match to d4ju0a_
    complexed with nag, sia; mutant

Details for d4ju0g_

PDB Entry: 4ju0 (more details), 2.91 Å

PDB Description: crystal structure of 2009 pandemic influenza virus hemagglutinin mutant d225e complexed with human receptor analogue lstc
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4ju0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ju0g_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnip

SCOPe Domain Coordinates for d4ju0g_:

Click to download the PDB-style file with coordinates for d4ju0g_.
(The format of our PDB-style files is described here.)

Timeline for d4ju0g_: