SCOPe 2.07: Domain d1bvkd_: 1bvk D:

Lineage for d1bvkd_ (1bvk D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (63 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1bvkd_: 1bvk D: [20280]
   Other proteins in same PDB: d1bvkb1, d1bvkb2, d1bvkc_, d1bvke1, d1bvke2, d1bvkf_
   part of humanized anti-lysozyme Fv HuLys11

Details for d1bvkd_

PDB Entry: 1bvk, 2.7 Å

PDB Description: humanized anti-lysozyme fv complexed with lysozyme

PDB Compounds: (D:) hulys11

SCOPe Domain Sequences for d1bvkd_:

Sequence; same for both SEQRES and ATOM records:

>d1bvkd_ b.1.1.1 (D:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps
rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr

Timeline for d1bvkd_:

• d1bvkd_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvkd_ appears in SCOPe 2.06
  
• d1bvkd_ appears in the current release, SCOPe 2.08