Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain [48858] (2 PDB entries) |
Domain d1bvkd_: 1bvk D: [20280] Other proteins in same PDB: d1bvkc_, d1bvkf_ |
PDB Entry: 1bvk (more details), 2.7 Å
SCOP Domain Sequences for d1bvkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvkd_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain} diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr
Timeline for d1bvkd_: