Lineage for d1bvkd_ (1bvk D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52628Species Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain [48858] (2 PDB entries)
  8. 52631Domain d1bvkd_: 1bvk D: [20280]
    Other proteins in same PDB: d1bvkc_, d1bvkf_

Details for d1bvkd_

PDB Entry: 1bvk (more details), 2.7 Å

PDB Description: humanized anti-lysozyme fv complexed with lysozyme

SCOP Domain Sequences for d1bvkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvkd_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain}
diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps
rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr

SCOP Domain Coordinates for d1bvkd_:

Click to download the PDB-style file with coordinates for d1bvkd_.
(The format of our PDB-style files is described here.)

Timeline for d1bvkd_: