Lineage for d4jsuv_ (4jsu V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228638Domain d4jsuv_: 4jsu V: [202791]
    Other proteins in same PDB: d4jsua_, d4jsue_, d4jsui_, d4jsuj_, d4jsuk_, d4jsul_, d4jsum_, d4jsun_, d4jsuo_, d4jsus_, d4jsuw_, d4jsux_, d4jsuy_, d4jsuz_
    automated match to d2zcyh_
    complexed with mes

Details for d4jsuv_

PDB Entry: 4jsu (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:3a
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4jsuv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jsuv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4jsuv_:

Click to download the PDB-style file with coordinates for d4jsuv_.
(The format of our PDB-style files is described here.)

Timeline for d4jsuv_: