SCOP 1.63: Domain d1bvkb_: 1bvk B:

Lineage for d1bvkb_ (1bvk B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain [48858] (2 PDB entries)

8. Domain d1bvkb_: 1bvk B: [20279]
   Other proteins in same PDB: d1bvkc_, d1bvkf_

Details for d1bvkb_

PDB Entry: 1bvk, 2.7 Å

PDB Description: humanized anti-lysozyme fv complexed with lysozyme

SCOP Domain Sequences for d1bvkb_:

Sequence; same for both SEQRES and ATOM records:

>d1bvkb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Humanized anti-lysozyme Fv HuLys11 (mouse), kappa L chain}
qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss

Timeline for d1bvkb_:

• d1bvkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvkb_ appears in SCOP 1.61
  
• d1bvkb_ appears in SCOP 1.65
  
• d1bvkb_ appears in the current release, SCOPe 2.08, called d1bvkb1