Lineage for d4jsqv_ (4jsq V:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439179Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (34 PDB entries)
  8. 1439277Domain d4jsqv_: 4jsq V: [202771]
    Other proteins in same PDB: d4jsqa_, d4jsqe_, d4jsqi_, d4jsqj_, d4jsqk_, d4jsql_, d4jsqm_, d4jsqn_, d4jsqo_, d4jsqs_, d4jsqw_, d4jsqx_, d4jsqy_, d4jsqz_
    automated match to d2zcyh_
    complexed with mes

Details for d4jsqv_

PDB Entry: 4jsq (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4e
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4jsqv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jsqv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d4jsqv_:

Click to download the PDB-style file with coordinates for d4jsqv_.
(The format of our PDB-style files is described here.)

Timeline for d4jsqv_: