Lineage for d1c9rh1 (1c9r H:1-123)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7382Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (2 PDB entries)
  8. 7385Domain d1c9rh1: 1c9r H:1-123 [20277]
    Other proteins in same PDB: d1c9ra1, d1c9ra2, d1c9rb1, d1c9rh2, d1c9rl2

Details for d1c9rh1

PDB Entry: 1c9r (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1c9rh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9rh1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1c9rh1:

Click to download the PDB-style file with coordinates for d1c9rh1.
(The format of our PDB-style files is described here.)

Timeline for d1c9rh1: