SCOPe 2.03: Domain d2hmid1: 2hmi D:1-123

Lineage for d2hmid1 (2hmi D:1-123)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
   SQ NA # part of Fab 28 against HIV-1 RT

8. Domain d2hmid1: 2hmi D:1-123 [20275]
   Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic1, d2hmic2, d2hmid2
   part of Fab 28 against HIV-1 RT
   protein/DNA complex

Details for d2hmid1

PDB Entry: 2hmi, 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

PDB Compounds: (D:) fab fragment of monoclonal antibody 28

SCOPe Domain Sequences for d2hmid1:

Sequence; same for both SEQRES and ATOM records:

>d2hmid1 b.1.1.1 (D:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

Timeline for d2hmid1:

• d2hmid1 first appeared (with stable ids) in SCOP 1.55
  
• d2hmid1 appears in SCOPe 2.02
  
• d2hmid1 appears in SCOPe 2.04
  
• d2hmid1 appears in the current release, SCOPe 2.08