Lineage for d2hmid1 (2hmi D:1-123)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219437Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)
  8. 219439Domain d2hmid1: 2hmi D:1-123 [20275]
    Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib_, d2hmic2, d2hmid2
    protein/protein/DNA complex; mutant

Details for d2hmid1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmid1 b.1.1.1 (D:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d2hmid1:

Click to download the PDB-style file with coordinates for d2hmid1.
(The format of our PDB-style files is described here.)

Timeline for d2hmid1: