SCOP 1.61: Domain d2hmid1: 2hmi D:1-123

Lineage for d2hmid1 (2hmi D:1-123)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (3 PDB entries)
Domain d2hmid1: 2hmi D:1-123 [20275]
Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib1, d2hmic2, d2hmid2

Details for d2hmid1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmid1 b.1.1.1 (D:1-123) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d2hmid1:

Click to download the PDB-style file with coordinates for d2hmid1.
(The format of our PDB-style files is described here.)

Timeline for d2hmid1: