| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (35 PDB entries) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) |
| Domain d1adqh1: 1adq H:1-113 [20273] Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh2, d1adql1, d1adql2 part of IgM rheumatoid factor Fab |
PDB Entry: 1adq (more details), 3.15 Å
SCOPe Domain Sequences for d1adqh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adqh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvqpgrslrlscvtsgftfddyamhwvrqspgkglewvsgiswntgtiiy
adsvkgrfiisrdnaknslylqmnslrvedtalyycaktrsyvvaaeyyfhywgqgilvt
vss
Timeline for d1adqh1:
View in 3DDomains from other chains: (mouse over for more information) d1adqa1, d1adqa2, d1adql1, d1adql2 |