Lineage for d1adqh1 (1adq H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362839Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (11 PDB entries)
  8. 362853Domain d1adqh1: 1adq H:1-113 [20273]
    Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh2, d1adql1, d1adql2
    part of IgM rheumatoid factor Fab

Details for d1adqh1

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adqh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3}
evqlvesggglvqpgrslrlscvtsgftfddyamhwvrqspgkglewvsgiswntgtiiy
adsvkgrfiisrdnaknslylqmnslrvedtalyycaktrsyvvaaeyyfhywgqgilvt
vss

SCOP Domain Coordinates for d1adqh1:

Click to download the PDB-style file with coordinates for d1adqh1.
(The format of our PDB-style files is described here.)

Timeline for d1adqh1: