SCOP 1.55: Domain d1adqh1: 1adq H:1-113

Lineage for d1adqh1 (1adq H:1-113)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species IgM rheumatoid factor Fab (human), lambda L chain [48856] (1 PDB entry)

8. Domain d1adqh1: 1adq H:1-113 [20273]
   Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh2, d1adql2

Details for d1adqh1

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqh1:

Sequence; same for both SEQRES and ATOM records:

>d1adqh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {IgM rheumatoid factor Fab (human), lambda L chain}
evqlvesggglvqpgrslrlscvtsgftfddyamhwvrqspgkglewvsgiswntgtiiy
adsvkgrfiisrdnaknslylqmnslrvedtalyycaktrsyvvaaeyyfhywgqgilvt
vss

Timeline for d1adqh1:

• d1adqh1 appears in SCOP 1.57
  
• d1adqh1 appears in the current release, SCOPe 2.08