Lineage for d1adqh1 (1adq H:1-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7943Species IgM rheumatoid factor Fab (human), lambda L chain [48856] (1 PDB entry)
  8. 7944Domain d1adqh1: 1adq H:1-113 [20273]
    Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh2, d1adql2

Details for d1adqh1

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adqh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {IgM rheumatoid factor Fab (human), lambda L chain}
evqlvesggglvqpgrslrlscvtsgftfddyamhwvrqspgkglewvsgiswntgtiiy
adsvkgrfiisrdnaknslylqmnslrvedtalyycaktrsyvvaaeyyfhywgqgilvt
vss

SCOP Domain Coordinates for d1adqh1:

Click to download the PDB-style file with coordinates for d1adqh1.
(The format of our PDB-style files is described here.)

Timeline for d1adqh1: