Lineage for d12e8p1 (12e8 P:1-114)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103878Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 1103884Domain d12e8p1: 12e8 P:1-114 [20271]
    Other proteins in same PDB: d12e8h2, d12e8l1, d12e8l2, d12e8m1, d12e8m2, d12e8p2
    part of Fab 2E8 specific to the low density lipoprotein receptor binding region of apolipoprotein E

Details for d12e8p1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment
PDB Compounds: (P:) igg1-kappa 2e8 fab (heavy chain)

SCOPe Domain Sequences for d12e8p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8p1 b.1.1.1 (P:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
a

SCOPe Domain Coordinates for d12e8p1:

Click to download the PDB-style file with coordinates for d12e8p1.
(The format of our PDB-style files is described here.)

Timeline for d12e8p1: