SCOPe 2.06: Domain d4j5ib1: 4j5i B:3-293

Lineage for d4j5ib1 (4j5i B:3-293)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.0: automated matches [191672] (1 protein)
   not a true family

6. Protein automated matches [191281] (13 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [193240] (1 PDB entry)

8. Domain d4j5ib1: 4j5i B:3-293 [202700]
   Other proteins in same PDB: d4j5ib2, d4j5ic2, d4j5ie2, d4j5ih2
   automated match to d4j5ia_
   complexed with edo, fe, mg

Details for d4j5ib1

PDB Entry: 4j5i, 2.6 Å

PDB Description: crystal structure of an alpha-ketoglutarate-dependent taurine dioxygenase from mycobacterium smegmatis

PDB Compounds: (B:) Alpha-Ketoglutarate-Dependent Taurine Dioxygenase

SCOPe Domain Sequences for d4j5ib1:

Sequence, based on SEQRES records:

>d4j5ib1 b.82.2.0 (B:3-293) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
qvtvtklgahigaridgvrvggdlspatvsainaallehkviffsgqdhlddagqlefae
llgtptvahptlaegaeqllpidsrydkanswhtdvtfvdripkasllravtlpsyggtt
awasteaayqqlpaplrtladnlwavhtnrfdyadsaisaeqrgyrqrfesdyyevehpv
vrvhpetgervlllghfvksfvglkdtesaalfrlfqdritrlentvrwswkpgdlaiwd
nratqhyavadyddqyrrlnrvtlagdipvdvygersrviagdassyspvd

Sequence, based on observed residues (ATOM records):

>d4j5ib1 b.82.2.0 (B:3-293) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
qvtvtklgahigaridgvrvggdlspatvsainaallehkviffsgqdhlddagqlefae
llgtptvahptlaegaeqllpidsrydkanswhtdvtfvdripkasllravtlpsyggtt
awasteaayqqlpaplrtladnlwavhtnrisaeqrgyrqrfesdyyevehpvvrvhpet
gervlllghfvksfvglkdtesaalfrlfqdritrlentvrwswkpgdlaiwdnratqhy
avadyddqyrrlnrvtlagdipvdvygersrviagdassyspvd

Timeline for d4j5ib1:

• d4j5ib1 first appeared in SCOPe 2.03, called d4j5ib_
  
• d4j5ib1 was called d4j5ib_ in SCOPe 2.05
  
• d4j5ib1 appears in SCOPe 2.07
  
• d4j5ib1 appears in the current release, SCOPe 2.08