Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (13 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [193240] (1 PDB entry) |
Domain d4j5ib1: 4j5i B:3-293 [202700] Other proteins in same PDB: d4j5ib2, d4j5ic2, d4j5ie2, d4j5ih2 automated match to d4j5ia_ complexed with edo, fe, mg |
PDB Entry: 4j5i (more details), 2.6 Å
SCOPe Domain Sequences for d4j5ib1:
Sequence, based on SEQRES records: (download)
>d4j5ib1 b.82.2.0 (B:3-293) automated matches {Mycobacterium smegmatis [TaxId: 246196]} qvtvtklgahigaridgvrvggdlspatvsainaallehkviffsgqdhlddagqlefae llgtptvahptlaegaeqllpidsrydkanswhtdvtfvdripkasllravtlpsyggtt awasteaayqqlpaplrtladnlwavhtnrfdyadsaisaeqrgyrqrfesdyyevehpv vrvhpetgervlllghfvksfvglkdtesaalfrlfqdritrlentvrwswkpgdlaiwd nratqhyavadyddqyrrlnrvtlagdipvdvygersrviagdassyspvd
>d4j5ib1 b.82.2.0 (B:3-293) automated matches {Mycobacterium smegmatis [TaxId: 246196]} qvtvtklgahigaridgvrvggdlspatvsainaallehkviffsgqdhlddagqlefae llgtptvahptlaegaeqllpidsrydkanswhtdvtfvdripkasllravtlpsyggtt awasteaayqqlpaplrtladnlwavhtnrisaeqrgyrqrfesdyyevehpvvrvhpet gervlllghfvksfvglkdtesaalfrlfqdritrlentvrwswkpgdlaiwdnratqhy avadyddqyrrlnrvtlagdipvdvygersrviagdassyspvd
Timeline for d4j5ib1: