Lineage for d12e8m1 (12e8 M:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219456Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry)
    specific to the low density lipoprotein receptor binding region of apolipoprotein E
  8. 219459Domain d12e8m1: 12e8 M:1-107 [20270]
    Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2

Details for d12e8m1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8m1 b.1.1.1 (M:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelk

SCOP Domain Coordinates for d12e8m1:

Click to download the PDB-style file with coordinates for d12e8m1.
(The format of our PDB-style files is described here.)

Timeline for d12e8m1: