![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry) |
![]() | Domain d12e8m1: 12e8 M:1-107 [20270] Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2 |
PDB Entry: 12e8 (more details), 1.9 Å
SCOP Domain Sequences for d12e8m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d12e8m1 b.1.1.1 (M:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain} divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklmiysasnrytgvpd rftgsgsgtdftltisnmqsedladyfcqqyssypltfgagtklelk
Timeline for d12e8m1: