SCOPe 2.02: Domain d12e8h1: 12e8 H:1-114

Lineage for d12e8h1 (12e8 H:1-114)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

Domain d12e8h1: 12e8 H:1-114 [20269]
Other proteins in same PDB: d12e8h2, d12e8l1, d12e8l2, d12e8m1, d12e8m2, d12e8p2
part of Fab 2E8 specific to the low density lipoprotein receptor binding region of apolipoprotein E

Details for d12e8h1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment

PDB Compounds: (H:) igg1-kappa 2e8 fab (heavy chain)

SCOPe Domain Sequences for d12e8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8h1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
a

SCOPe Domain Coordinates for d12e8h1:

Click to download the PDB-style file with coordinates for d12e8h1.
(The format of our PDB-style files is described here.)

Timeline for d12e8h1: