Lineage for d12e8h1 (12e8 H:1-114)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52061Species Fab 2E8 (mouse), kappa L chain [48855] (1 PDB entry)
  8. 52062Domain d12e8h1: 12e8 H:1-114 [20269]
    Other proteins in same PDB: d12e8h2, d12e8l2, d12e8m2, d12e8p2

Details for d12e8h1

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8h1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
evqlqqsgaevvrsgasvklsctasgfnikdyyihwvkqrpekglewigwidpeigdtey
vpkfqgkatmtadtssntaylqlssltsedtavyycnaghdydrgrfpywgqgtlvtvsa
a

SCOP Domain Coordinates for d12e8h1:

Click to download the PDB-style file with coordinates for d12e8h1.
(The format of our PDB-style files is described here.)

Timeline for d12e8h1: