Lineage for d1g9nh1 (1g9n H:1-129)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510554Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1510604Domain d1g9nh1: 1g9n H:1-129 [20267]
    Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh2, d1g9nl1, d1g9nl2
    part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
    complexed with nag, ndg

Details for d1g9nh1

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (H:) antibody 17b, heavy chain

SCOPe Domain Sequences for d1g9nh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nh1 b.1.1.1 (H:1-129) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeyrnngflkhwgq
gtlvtvtsa

SCOPe Domain Coordinates for d1g9nh1:

Click to download the PDB-style file with coordinates for d1g9nh1.
(The format of our PDB-style files is described here.)

Timeline for d1g9nh1: