Lineage for d4iosf_ (4ios F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513029Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)
  8. 1513121Domain d4iosf_: 4ios F: [202663]
    Other proteins in same PDB: d4iosa_, d4iosb_, d4iosc_, d4iosh_
    automated match to d4iosd_
    complexed with gol

Details for d4iosf_

PDB Entry: 4ios (more details), 2.4 Å

PDB Description: structure of phage tp901-1 rbp (orf49) in complex with nanobody 11.
PDB Compounds: (F:) Llama nanobody 11

SCOPe Domain Sequences for d4iosf_:

Sequence, based on SEQRES records: (download)

>d4iosf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlscavsgrtfssnvigwfrqapgkerefvaaiswstgstyyg
rsmkgrcaasrdnakntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtv
s

Sequence, based on observed residues (ATOM records): (download)

>d4iosf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlscavsgsnvigwfrqapgkerefvaaiswstgstyygrsmk
grcaasrdkntvalqlnslkpedtavyycaatldwgktlsdeydywgqgtqvtvs

SCOPe Domain Coordinates for d4iosf_:

Click to download the PDB-style file with coordinates for d4iosf_.
(The format of our PDB-style files is described here.)

Timeline for d4iosf_: