Lineage for d4intq_ (4int Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228510Domain d4intq_: 4int Q: [202657]
    Other proteins in same PDB: d4inta_, d4inte_, d4intf_, d4inti_, d4intj_, d4intk_, d4intl_, d4intm_, d4intn_, d4into_, d4ints_, d4intt_, d4intw_, d4intx_, d4inty_, d4intz_
    automated match to d2zcyc_
    complexed with 1g5

Details for d4intq_

PDB Entry: 4int (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU122
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d4intq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4intq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d4intq_:

Click to download the PDB-style file with coordinates for d4intq_.
(The format of our PDB-style files is described here.)

Timeline for d4intq_: