Lineage for d4intq1 (4int Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993416Domain d4intq1: 4int Q:1-234 [202657]
    Other proteins in same PDB: d4inta_, d4intc2, d4inte_, d4intf_, d4inti_, d4intj_, d4intk_, d4intl_, d4intm_, d4intn_, d4into_, d4intq2, d4ints_, d4intt_, d4intw_, d4intx_, d4inty_, d4intz_
    automated match to d2zcyc_
    complexed with 1g5

Details for d4intq1

PDB Entry: 4int (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU122
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d4intq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4intq1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4intq1:

Click to download the PDB-style file with coordinates for d4intq1.
(The format of our PDB-style files is described here.)

Timeline for d4intq1: