Lineage for d4intp_ (4int P:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439179Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (34 PDB entries)
  8. 1439265Domain d4intp_: 4int P: [202656]
    Other proteins in same PDB: d4inta_, d4inte_, d4inti_, d4intj_, d4intk_, d4intl_, d4intm_, d4intn_, d4into_, d4ints_, d4intw_, d4intx_, d4inty_, d4intz_
    automated match to d2zcyb_
    complexed with 1g5

Details for d4intp_

PDB Entry: 4int (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU122
PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d4intp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4intp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4intp_:

Click to download the PDB-style file with coordinates for d4intp_.
(The format of our PDB-style files is described here.)

Timeline for d4intp_: