Lineage for d4inte_ (4int E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225086Domain d4inte_: 4int E: [202648]
    Other proteins in same PDB: d4inta_, d4intb_, d4intc_, d4intd_, d4intf_, d4intg_, d4inth_, d4inti_, d4intj_, d4intl_, d4intm_, d4intn_, d4into_, d4intp_, d4intq_, d4intr_, d4intt_, d4intu_, d4intv_, d4intw_, d4intx_, d4intz_
    automated match to d2zcye_
    complexed with 1g5

Details for d4inte_

PDB Entry: 4int (more details), 2.9 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU122
PDB Compounds: (E:) Proteasome component PRE5

SCOPe Domain Sequences for d4inte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inte_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d4inte_:

Click to download the PDB-style file with coordinates for d4inte_.
(The format of our PDB-style files is described here.)

Timeline for d4inte_: