Lineage for d4inri_ (4inr I:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438480Domain d4inri_: 4inr I: [202632]
    Other proteins in same PDB: d4inrb_, d4inrc_, d4inrd_, d4inre_, d4inrg_, d4inrh_, d4inrk_, d4inrp_, d4inrq_, d4inrr_, d4inrs_, d4inru_, d4inrv_, d4inry_
    automated match to d1g0ui_
    complexed with 1g1

Details for d4inri_

PDB Entry: 4inr (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU102
PDB Compounds: (I:) Proteasome component PUP3

SCOPe Domain Sequences for d4inri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inri_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d4inri_:

Click to download the PDB-style file with coordinates for d4inri_.
(The format of our PDB-style files is described here.)

Timeline for d4inri_: