SCOPe 2.04: Domain d4in6h2: 4in6 H:36-250

Lineage for d4in6h2 (4in6 H:36-250)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein automated matches [226918] (2 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)

8. Domain d4in6h2: 4in6 H:36-250 [202624]
   Other proteins in same PDB: d4in6h1, d4in6l_, d4in6m_
   automated match to d1l9bh1
   complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10; mutant

Details for d4in6h2

PDB Entry: 4in6, 2.7 Å

PDB Description: (m)l214a mutant of the rhodobacter sphaeroides reaction center

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d4in6h2:

Sequence; same for both SEQRES and ATOM records:

>d4in6h2 b.41.1.1 (H:36-250) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d4in6h2:

• d4in6h2 first appeared in SCOPe 2.03
  
• d4in6h2 appears in SCOPe 2.05
  
• d4in6h2 appears in the current release, SCOPe 2.08