SCOP 1.69: Domain d1a6vj_: 1a6v J:

Lineage for d1a6vj_ (1a6v J:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1a6vj_: 1a6v J: [20261]
   Other proteins in same PDB: d1a6vl_, d1a6vm_, d1a6vn_
   part of Fv B1-8; this domain is identical to the N-terminal domain of scFv 1NQB

Details for d1a6vj_

PDB Entry: 1a6v, 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6vj_:

Sequence; same for both SEQRES and ATOM records:

>d1a6vj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

Timeline for d1a6vj_:

• d1a6vj_ first appeared (with stable ids) in SCOP 1.55
  
• d1a6vj_ appears in SCOP 1.67
  
• d1a6vj_ appears in SCOP 1.71
  
• d1a6vj_ appears in the current release, SCOPe 2.08