SCOPe 2.03: Domain d4ibxe_: 4ibx E:

Lineage for d4ibxe_ (4ibx E:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (36 PDB entries)

8. Domain d4ibxe_: 4ibx E: [202606]
   automated match to d4ibxb_
   complexed with ca, mes, so4

Details for d4ibxe_

PDB Entry: 4ibx, 2.68 Å

PDB Description: Crystal structure of stabilized TEM-1 beta-lactamase variant v.13

PDB Compounds: (E:) Beta-lactamase TEM

SCOPe Domain Sequences for d4ibxe_:

Sequence; same for both SEQRES and ATOM records:

>d4ibxe_ e.3.1.1 (E:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

Timeline for d4ibxe_:

• d4ibxe_ is new in SCOPe 2.03-stable
  
• d4ibxe_ appears in SCOPe 2.04
  
• d4ibxe_ appears in the current release, SCOPe 2.08