Lineage for d4ibxe_ (4ibx E:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013034Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries)
  8. 3013139Domain d4ibxe_: 4ibx E: [202606]
    automated match to d4ibxb_
    complexed with ca, mes, so4

Details for d4ibxe_

PDB Entry: 4ibx (more details), 2.68 Å

PDB Description: Crystal structure of stabilized TEM-1 beta-lactamase variant v.13
PDB Compounds: (E:) Beta-lactamase TEM

SCOPe Domain Sequences for d4ibxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibxe_ e.3.1.1 (E:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d4ibxe_:

Click to download the PDB-style file with coordinates for d4ibxe_.
(The format of our PDB-style files is described here.)

Timeline for d4ibxe_: