Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries) |
Domain d4ibxc_: 4ibx C: [202604] automated match to d4ibxb_ complexed with ca, mes, so4 |
PDB Entry: 4ibx (more details), 2.68 Å
SCOPe Domain Sequences for d4ibxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ibxc_ e.3.1.1 (C:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]} hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymtg sqatmdernrqiaeigaslikhw
Timeline for d4ibxc_:
View in 3D Domains from other chains: (mouse over for more information) d4ibxa_, d4ibxb_, d4ibxd_, d4ibxe_ |