Lineage for d1a6vn_ (1a6v N:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757501Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1757592Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)
  8. 1757613Domain d1a6vn_: 1a6v N: [20260]
    Other proteins in same PDB: d1a6vh_, d1a6vi_, d1a6vj_
    part of Fv B1-8
    complexed with npc

Details for d1a6vn_

PDB Entry: 1a6v (more details), 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
PDB Compounds: (N:) b1-8 fv (light chain)

SCOPe Domain Sequences for d1a6vn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6vn_ b.1.1.1 (N:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOPe Domain Coordinates for d1a6vn_:

Click to download the PDB-style file with coordinates for d1a6vn_.
(The format of our PDB-style files is described here.)

Timeline for d1a6vn_: