Lineage for d1a6vi_ (1a6v I:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782204Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
    SQ NA # humanized antibody
    Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
    Uniprot P01750 20-116 #
    HV06_MOUSE Ig heavy chain V region 102 precursor
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 782305Domain d1a6vi_: 1a6v I: [20259]
    Other proteins in same PDB: d1a6vl_, d1a6vm_, d1a6vn_
    part of Fv B1-8; this domain is identical to the N-terminal domain of scFv 1NQB

Details for d1a6vi_

PDB Entry: 1a6v (more details), 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
PDB Compounds: (I:) b1-8 fv (heavy chain)

SCOP Domain Sequences for d1a6vi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6vi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvs

SCOP Domain Coordinates for d1a6vi_:

Click to download the PDB-style file with coordinates for d1a6vi_.
(The format of our PDB-style files is described here.)

Timeline for d1a6vi_: