SCOPe 2.06: Domain d4i7fa1: 4i7f A:1-429

Lineage for d4i7fa1 (4i7f A:1-429)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (4 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries)

8. Domain d4i7fa1: 4i7f A:1-429 [202581]
   Other proteins in same PDB: d4i7fa2
   automated match to d1c1ba2
   complexed with cl, mg, nve, so4

Details for d4i7fa1

PDB Entry: 4i7f, 2.5 Å

PDB Description: hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d4i7fa1:

Sequence; same for both SEQRES and ATOM records:

>d4i7fa1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d4i7fa1:

• d4i7fa1 first appeared in SCOPe 2.03
  
• d4i7fa1 appears in SCOPe 2.05
  
• d4i7fa1 appears in SCOPe 2.07
  
• d4i7fa1 appears in the current release, SCOPe 2.08