SCOP 1.75: Domain d1a6vm_: 1a6v M:

Lineage for d1a6vm_ (1a6v M:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)

8. Domain d1a6vm_: 1a6v M: [20258]
   Other proteins in same PDB: d1a6vh_, d1a6vi_, d1a6vj_
   part of Fv B1-8

Details for d1a6vm_

PDB Entry: 1a6v, 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound

PDB Compounds: (M:) b1-8 fv (light chain)

SCOP Domain Sequences for d1a6vm_:

Sequence; same for both SEQRES and ATOM records:

>d1a6vm_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

Timeline for d1a6vm_:

• d1a6vm_ first appeared (with stable ids) in SCOP 1.55
  
• d1a6vm_ appears in SCOP 1.73
  
• d1a6vm_ appears in SCOPe 2.01
  
• d1a6vm_ appears in the current release, SCOPe 2.08