Lineage for d1a6vm_ (1a6v M:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547970Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 548055Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)
  8. 548073Domain d1a6vm_: 1a6v M: [20258]
    Other proteins in same PDB: d1a6vh_, d1a6vi_, d1a6vj_

Details for d1a6vm_

PDB Entry: 1a6v (more details), 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6vm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6vm_ b.1.1.1 (M:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgslignkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOP Domain Coordinates for d1a6vm_:

Click to download the PDB-style file with coordinates for d1a6vm_.
(The format of our PDB-style files is described here.)

Timeline for d1a6vm_: