SCOP 1.65: Domain d1a6vh_: 1a6v H:

Lineage for d1a6vh_ (1a6v H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1a6vh_: 1a6v H: [20257]
   Other proteins in same PDB: d1a6vl_, d1a6vm_, d1a6vn_

Details for d1a6vh_

PDB Entry: 1a6v, 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6vh_:

Sequence; same for both SEQRES and ATOM records:

>d1a6vh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtv

Timeline for d1a6vh_:

• d1a6vh_ first appeared (with stable ids) in SCOP 1.55
  
• d1a6vh_ appears in SCOP 1.63
  
• d1a6vh_ appears in SCOP 1.67
  
• d1a6vh_ appears in the current release, SCOPe 2.08