Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries) |
Domain d4i5eg_: 4i5e G: [202559] automated match to d4i5ea_ complexed with gol, nap |
PDB Entry: 4i5e (more details), 2.8 Å
SCOPe Domain Sequences for d4i5eg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5eg_ c.2.1.0 (G:) automated matches {Ralstonia sp. [TaxId: 517192]} ayrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkad vtkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvq kalpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavsp gaidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagiel fvdggltqv
Timeline for d4i5eg_: