Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [197025] (3 PDB entries) |
Domain d4i4zh_: 4i4z H: [202544] automated match to d4i4za_ complexed with 2ne, bct, mli |
PDB Entry: 4i4z (more details), 2 Å
SCOPe Domain Sequences for d4i4zh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i4zh_ c.14.1.0 (H:) automated matches {Synechocystis sp. [TaxId: 1111708]} mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll tgagphsdgkyafcsggdqsvrgeggyiddqgtprlnvldlqrlirsmpkvvialvagya iggghvlhlvcdltiaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqy saqeaermgmvntvvpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqela gnatllyymteegsegkqaflekrppdfsqypwlp
Timeline for d4i4zh_: