Lineage for d4i4zh_ (4i4z H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854364Species Synechocystis sp. [TaxId:1111708] [197025] (3 PDB entries)
  8. 2854378Domain d4i4zh_: 4i4z H: [202544]
    automated match to d4i4za_
    complexed with 2ne, bct, mli

Details for d4i4zh_

PDB Entry: 4i4z (more details), 2 Å

PDB Description: Synechocystis sp. PCC 6803 1,4-dihydroxy-2-naphthoyl-coenzyme A synthase (MenB) in complex with salicylyl-CoA
PDB Compounds: (H:) naphthoate synthase

SCOPe Domain Sequences for d4i4zh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i4zh_ c.14.1.0 (H:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll
tgagphsdgkyafcsggdqsvrgeggyiddqgtprlnvldlqrlirsmpkvvialvagya
iggghvlhlvcdltiaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqy
saqeaermgmvntvvpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqela
gnatllyymteegsegkqaflekrppdfsqypwlp

SCOPe Domain Coordinates for d4i4zh_:

Click to download the PDB-style file with coordinates for d4i4zh_.
(The format of our PDB-style files is described here.)

Timeline for d4i4zh_: