Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein automated matches [227027] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries) |
Domain d4i3zd2: 4i3z D:310-431 [202537] Other proteins in same PDB: d4i3za_, d4i3zc_ automated match to d1oiub2 complexed with adp, cl, gol, mg |
PDB Entry: 4i3z (more details), 2.05 Å
SCOPe Domain Sequences for d4i3zd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i3zd2 a.74.1.1 (D:310-431) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tvnqfltqyflhlqpanckveslamflgelslidadpylkylpsliagaafhlalytvtg qswpeslaqqtgytleslkpclvdlhqtylkapqhaqqsirekykhskyhsvsllnppet ls
Timeline for d4i3zd2:
View in 3D Domains from other chains: (mouse over for more information) d4i3za_, d4i3zb1, d4i3zb2, d4i3zc_ |