SCOPe 2.04: Domain d4i3zd1: 4i3z D:175-309

Lineage for d4i3zd1 (4i3z D:175-309)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries)

8. Domain d4i3zd1: 4i3z D:175-309 [202536]
   Other proteins in same PDB: d4i3za_, d4i3zc_
   automated match to d1finb1
   complexed with adp, cl, gol, mg

Details for d4i3zd1

PDB Entry: 4i3z, 2.05 Å

PDB Description: structure of pcdk2/cyclina bound to adp and 2 magnesium ions

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4i3zd1:

Sequence; same for both SEQRES and ATOM records:

>d4i3zd1 a.74.1.1 (D:175-309) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vpdyqedihtylremevkckpkvgymkrqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyskkqvlrm
ehlvlkvlafdlaap

Timeline for d4i3zd1:

• d4i3zd1 first appeared in SCOPe 2.03
  
• d4i3zd1 appears in SCOPe 2.05
  
• d4i3zd1 appears in the current release, SCOPe 2.08