SCOP 1.71: Domain d1a6wh_: 1a6w H:

Lineage for d1a6wh_ (1a6w H:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1a6wh_: 1a6w H: [20253]
   Other proteins in same PDB: d1a6wl_
   part of Fv B1-8; this domain is identical to the N-terminal domain of scFv 1NQB
   complexed with nip

Details for d1a6wh_

PDB Entry: 1a6w, 1.8 Å

PDB Description: b1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound

SCOP Domain Sequences for d1a6wh_:

Sequence; same for both SEQRES and ATOM records:

>d1a6wh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

Timeline for d1a6wh_:

• d1a6wh_ first appeared (with stable ids) in SCOP 1.55
  
• d1a6wh_ appears in SCOP 1.69
  
• d1a6wh_ appears in SCOP 1.73
  
• d1a6wh_ appears in the current release, SCOPe 2.08